Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214938
StrainM_smegmatis_MKD8
Protein IDZP_20976383.1
Description propionyl-CoA carboxylase- beta subunit [Mycobacterium smegmatis MKD
Sequence MTALHSTIDATSPGFNEAAAVMTAKLSELDAEHAKALGGGGPKYVDRHHA
RGKLTARERVELLLDPDSPFLELSPLAAWGTDFAVGASVVTGIGAVEGVE
CLIVANDPTVKGGTSNPWTLKKILRANQIALQNRLPVISLVESGGADLPT
QKEIFIPGGQMFRDLTRLSAAGIPTIALVFGNSTAGGAYVPGMSDHVVMI
RERSKVFLAGPPLVKMATGEESDDESLGGAEMHARTSGLADYFALDEPDA
IRIGRRIVARLNWRKQGPAPAEVVEPRYNAEELIGIVPADLRVPFDPRDV
IARIVDDSDFDEFKPLYGSSLVTGWARLWGYPVGILANARGVLFSEESQK
ATQFIQLANRADTPLLFLHNTTGYMVGKQYEEGGMVKHGSMMINAVSNST
VPHISLLIGASYGAGHYGMCGRAYDPRFLFAWPSAKSAVMGGTQLAGVLS
IVSRAAAEARGQTVDEDADAALRAAVEAQIEAESLPMFLSGRLYDDGVID
PRDTRTVLGMCLSAIANAPVEGTSNFGVFRM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo