Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214977
StrainM_smegmatis_MKD8
Protein IDZP_20976422.1
Description peptidoglycan-binding LysM [Mycobacterium smegmatis MKD8]
Sequence MLQHRSSASLKGNPTNARERKSAQADDLDAAEVTDIIPFSEFSKAFDQFA
ALDTQISSAYDNLSAFEREARVIEAPELDDLNDTDDLEPVRLDIPSEFLA
DARDAGERSASRRKRNATHAYRDSHTDVSDGTAATDVIDMTGRRGAHRKE
TTGALKSRLMIAAMAAGATAAGAYSFGNGTEAQAADDTVLATGQTTVDGA
SVSGSNDGMQIVSVASNISSAVHAEEITKAAAFAQERAEREARLSRPLFV
MPTKGVWTSGFGYRWGVLHGGIDIANSIGTPIYAASDGVVTDVGPTAGYG
AWVKIRHSDGTVTLYGHINTWLVSVGERVMAGDQIATMGNRGYSTGPHLH
FEVLTNGTNRIDPVGWLAKRGLSPGSYVG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo