Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215214
StrainM_smegmatis_MKD8
Protein IDZP_20976498.1
Description transcriptional regulator- TetR family [Mycobacterium smegmatis MKD8
Sequence MGRHREFDVDKALDAALCVFWRKGYEGASYSDLTQATGVERPALYSAFGN
KEALFLRALDRYYERYMDFIPVALEQPTSREVAEHLLRSAADLNTRYPDH
TGCLGVQGCLVGTDDSEPIRRALVDARASGEASLRARFEDAHATGDLPKS
ANPAALAAFLMTVLHGMAVQAKAGFSRETLDAIIDQALSSWPTPDRGSAG
KATRKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo