Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215226
StrainM_smegmatis_MKD8
Protein IDZP_20976510.1
Description 3-ketoacyl-CoA thiolase [Mycobacterium smegmatis MKD8]
Sequence MLGGYQSDFARNLTRENLDFADLTREVIENTLAHAKIDANDIGVVHVANA
FGELFARQGHLGAMPATVLEGLWDTPSSRHEAACASGSVAALAAIADLRS
GAYDTALVVGVELEKTVPGDDAAAILGTAAWTGHEGADATYMWPWMFSEV
ADEYDRRHGLDPAHLRAIASLNFANARRNPNAQTRTWNVPDPLTDDDATN
PVVEGRIRRFDCSQMTDGGAGVVLVTDRWLRAHPGVTPQARIAGWGHRTV
GLGLQQKIDRADADPYLLPHVRGAVQDAFGRAQVTLDDIDGFEVHDCFTP
SEYLAIDHIGLTGPGESWKAIENGEIEIGGRLPINPSGGLIGGGHPVGAS
GVRMLLDATKQVSASAGEYQVEAAKTFGTLNFGGSTATTVSFVVTAGKE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo