Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215250
StrainM_smegmatis_MKD8
Protein IDZP_20976534.1
Description putative 2-(R)-hydroxypropyl-CoM dehydrogenase [Mycobacterium smegma
Sequence MQVAIITGASSGIGFGCATKLAEAGMAVLGVGRDMERLAELAQTIDAPDR
VATLALDLTDDDAPQRIVDAAVARWGKVDFLINNAGVGSPKPLHETDDES
LDYFLGLMLRAPFRLARDVIPHMGPGSAIINVTSTFAVVGGLRGGAYSAA
KGGLTALTTHIACQYGAQGIRCNAVAPGVTLTPMVATRLEDDRFRKINTE
MTPHQRLGRVQDVASTVAFLCSEGGSFINGQTIVVDGGWSSTKYLSDHAL
NSDWVPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo