Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215341
StrainM_smegmatis_MKD8
Protein IDZP_20976569.1
Description putative ABC-type aminoglycoside exporter [Mycobacterium smegmatis M
Sequence MVVTEPPQSHRDGLRSAPAIAPAPERKRAATDLRRLLPYLVPYRARWMTM
VVVAIVSLGATIAIPLMTKAVIDGPVRHQDSQGLWTLGAAAVGIGISEAV
LWFIRRWLVARATMGVEADIRKDLYARLQILPMSFHGRWQSGQLLSRVMN
DLSTIRRFMSFGLVFLILNGLQITVVTAILLAMYWPLGVVVLVSIVPIAA
TVLHFEREYTRLSRLAQDQTGHVATHVEESALGLRVVKSFGREDYVFDRF
DEQATRLYDTQVARVGVSAKFWTLLEVIPNLTLIVVLGFGAYAAGHGYVT
MGTLVAFITMMLSLVWPIASLGFLLSMTQESFTAANRIAEIFDAPREIVD
GPITEAPRGGRLQLRDVGFKFPDSDEWVLRGVNLTVEPGETVALVGSTGS
GKSVLAALFSRLYDVTEGQILIDGRDIRDLSLPALRRTVATAFEDPTLFS
MSVAENLRLGRSDATDDELEQAVEVAAAHFVYDLPFGLDTRIGEQGMSLS
GGQRQRLSLARAILAAPRILVLDDTLSALDVHTEARVTEALSRVLSSVTG
VIVAHRASTVLLADKVALLDRDAHGAGTVTHIGTHAELLAEVPQYRYLLA
ADDELDDDTERTCEWEDDEDLERLRRVHDERAAIDGLDEPEYLGQEVQRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo