Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215408
StrainM_smegmatis_MKD8
Protein IDZP_20976607.1
Description resuscitation-promoting factor rpfA- partial [Mycobacterium smegmati
Sequence MSGRHRKPTSSSSAKNVAKIAFTGAVLGGGGLGMAGQAMAATDGEWDQVA
RCESGGNWAINTGNGYHGGLQFSPSTWRAHGGTEFAPAAYMATKEEQIAV
AERVLASQGKGAWPTCGRGLSGATPRNVVAEPEPAPLDAPGVNGELPPPA
PVDMLAAPMPAPEGLPPAPEALPPAPEAPAPAPEALPPAPEALPSAPE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo