Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215838
StrainM_smegmatis_MKD8
Protein IDZP_20976660.1
Description gas vesicle protein K [Mycobacterium smegmatis MKD8]
Sequence MEKKSGRIEMDPEDVGRDLGRLVLTIVELLRQLMERQALRRVDVGDLSDD
TVERLGVGLMRLEEAMEELREYFGLRPEDFNIDLGPLGPLLPREHG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo