Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215869
StrainM_smegmatis_MKD8
Protein IDZP_20976691.1
Description phosphate transport system regulatory protein PhoU [Mycobacterium sm
Sequence MRIQYHEQLASLNDQLGAMCELAGTAMERATQSLLQADLVLAEQVISDHE
KMTTLSAQAEESAFVLLALQAPVAGDLRTVVSAIQIIADVDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGHAAREVLITRDPEKAARI
QEEDDAMDDLHGHLFTVLMDREWKHGVMAAVDVTLLSRFYERFADHAVEV
ARRVIFQVTGNYPDGDKVTTQQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo