Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215872
StrainM_smegmatis_MKD8
Protein IDZP_20976694.1
Description phosphate ABC transporter- ATP-binding protein [Mycobacterium smegma
Sequence MAKRLDLKDVNIYYGAFHAVADVSLAVQPRSVTAFIGPSGCGKSTVLRTL
NRMHEVIPGARVEGSVLLDGEDIYGPGVDPVGVRKTIGMVFQRPNPFPTM
SIRDNVVAGLKLQGVRNKKTLDEVAERSLRGANLWNEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIATLKLDYTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKIFSNPSQKATE
DYISGRFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo