Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215907
StrainM_smegmatis_MKD8
Protein IDZP_20976729.1
Description phosphoribosylformylglycinamidine synthase I [Mycobacterium smegmati
Sequence MGVITFPGTLDDIDAARAVRLAGAEAVSLWHADADLHGVDAVVVPGGFSY
GDYLRCGAIAKFAPVMGSVVEAANKGMPVLGICNGFQVLCEAGLLPGALT
RNAGLHFVCRDVWLEVASNTSAWTTRYETGADLLIPLKSGEGRYVASESV
LDELEGEDRVVFRYRENLNGSMRDIAGICSENRRVVGLMPHPEHATEALT
GPSDDGLGLFYSALDAILSV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo