Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215930
StrainM_smegmatis_MKD8
Protein IDZP_20976752.1
Description 4-carboxymuconolactone decarboxylase domain protein [Mycobacterium s
Sequence MDELRRKGLEKMNEVYGWEMPNIEGDPYFDLTVDHLFGTIWTREGLSMRE
KRLLTLASVTAVGNSDLAEIQVNAALHNEEFTVDELKEVAVFLTHYLGFP
LGSKLDGAVSKVARNRKKAAEKGEREDTAEKRRANVNAAVKMHSGSKLDD
K
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo