Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215967
StrainM_smegmatis_MKD8
Protein IDZP_20976789.1
Description hypothetical protein D806_5958 [Mycobacterium smegmatis MKD8]
Sequence MSSEPLDTTTPAPEVRAESTSPAPRPAPKLKPARVARRRPHRRLVAIVAA
VVLAVGTAVVGGLTYVLVDQQRTYEAAQERDQRFVDTAKQTVVNMFSYTQ
DTIDESVNRFIDGTSGPLRDMMSQGNNADNLKALFRDTQASSEAVVNGAA
LEKIDEIAKNASVLISVWVTVTDIDGVNAPTKPYRLRVIVHEDDNGHMTG
YDLKYPDGGN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo