Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441215986
StrainM_smegmatis_MKD8
Protein IDZP_20976808.1
Description enoyl-CoA hydratase/isomerase [Mycobacterium smegmatis MKD8]
Sequence MSETGKGPDALVEQRGHTLIVTLNRPEARNALSGEMLSIMVEAWDRVDND
PEIRTCILTGAGGYFCSGMDLKGADKKPPGDSFKDGSYDPSKIPGLLKGR
RLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGG
SAVRLVRQIPYTIACDMLLTGRHITAAEAKEYGLIGYVVPDGTALDKALE
IAETINNNGPLAVQAILKTIRETEGMHEDEAFGPDTRNGIPVFLSEDAKE
GPRAFKEKRAPNFQMK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo