Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216314
StrainM_smegmatis_MKD8
Protein IDZP_20976938.1
Description HTH-type transcriptional repressor KstR [Mycobacterium smegmatis MKD
Sequence MAVLSESELGSEAQRERRKRILDATLAIASKGGYEAVQMRAVAERADVAV
GTLYRYFPSKVHLLVSALGREFERIDAKTDRAALAGGTPYQRLNFMVGKL
NRAMQRNPLLTEAMTRAFVFADASAAGEVDHVGKLMDSMFARAMSDGEPT
EDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGTEEQPK
I
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo