Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216325
StrainM_smegmatis_MKD8
Protein IDZP_20976949.1
Description ABC transport protein- ATP-binding subunit [Mycobacterium smegmatis
Sequence MSAVRLNRITFGYNRNPVFTDLTVEFPRAACTAVTGPNGCGKSTLLSLIA
GVSRPHSGTVELCARDVALAVQRDEVARTFPITVAEAVMMGRWRRLGLLR
RPSRADRDIVDFWLTELGLDDLRTCRMTELSGGQRQRTLLAQAFAQQAPI
LLLDEPTASLDADSAQTVYRQLRRLASSGTTIVAATHDGDALDQFEHHLS
LTGLSGHAATLGSGRASTCVQPQRTASRIPSDHRTP
gene ID441216325
StrainM_smegmatis_MKD8
Protein IDZP_20976949.1
Description ABC transport protein- ATP-binding subunit [Mycobacterium smegmatis
Sequence MSAVRLNRITFGYNRNPVFTDLTVEFPRAACTAVTGPNGCGKSTLLSLIA
GVSRPHSGTVELCARDVALAVQRDEVARTFPITVAEAVMMGRWRRLGLLR
RPSRADRDIVDFWLTELGLDDLRTCRMTELSGGQRQRTLLAQAFAQQAPI
LLLDEPTASLDADSAQTVYRQLRRLASSGTTIVAATHDGDALDQFEHHLS
LTGLSGHAATLGSGRASTCVQPQRTASRIPSDHRTP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo