Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216361
StrainM_smegmatis_MKD8
Protein IDZP_20976985.1
Description antibiotic biosynthesis monooxygenase domain protein [Mycobacterium
Sequence MKINAIEVPPNAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVKGETRYFV
VTQWESEEAFQAWATGPAIEAHKGEQRNPVATGASLLEFEVVLDVAGSGD
KA
gene ID441216361
StrainM_smegmatis_MKD8
Protein IDZP_20976985.1
Description antibiotic biosynthesis monooxygenase domain protein [Mycobacterium
Sequence MKINAIEVPPNAGPELEKRFAHRAHAVDNQPGFLGFQLLRPVKGETRYFV
VTQWESEEAFQAWATGPAIEAHKGEQRNPVATGASLLEFEVVLDVAGSGD
KA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo