Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216491
StrainM_smegmatis_MKD8
Protein IDZP_20977011.1
Description putative hydrolase [Mycobacterium smegmatis MKD8]
Sequence MTAGRAVDWDFAASVGAKLARPEPPSTDYTRRQAIDQLSESARAAELPVR
EVTGLNEGAEVPEARVVDRPAWIRAATRSMRVMTTGGDTGDSDANGDKPG
FITGRVTGAQTGAVLAFISSGILGQYDPFGPDGGELLLVYPNVISVERQL
RVAPADFRLWVCLHEVTHRVQFRANPWLADHMSQALAVLTQDAGDDVAAL
AGRLAQYVRDQRGTNGSAPEPNSTGILGLMRAVQAEPQRRALDQLLVLGT
LLEGHADHVMDAVGPAVVPTVGTIRRRFDERRQRKQPPVQRVVRALLGFD
AKLSQYTRGKAFVDHVVSAVGMQRFNTVWTNAETLPLPTEIDEPQRWIDR
VL
gene ID441216491
StrainM_smegmatis_MKD8
Protein IDZP_20977011.1
Description putative hydrolase [Mycobacterium smegmatis MKD8]
Sequence MTAGRAVDWDFAASVGAKLARPEPPSTDYTRRQAIDQLSESARAAELPVR
EVTGLNEGAEVPEARVVDRPAWIRAATRSMRVMTTGGDTGDSDANGDKPG
FITGRVTGAQTGAVLAFISSGILGQYDPFGPDGGELLLVYPNVISVERQL
RVAPADFRLWVCLHEVTHRVQFRANPWLADHMSQALAVLTQDAGDDVAAL
AGRLAQYVRDQRGTNGSAPEPNSTGILGLMRAVQAEPQRRALDQLLVLGT
LLEGHADHVMDAVGPAVVPTVGTIRRRFDERRQRKQPPVQRVVRALLGFD
AKLSQYTRGKAFVDHVVSAVGMQRFNTVWTNAETLPLPTEIDEPQRWIDR
VL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo