Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216513
StrainM_smegmatis_MKD8
Protein IDZP_20977033.1
Description putative 5-dehydro-4-deoxyglucarate dehydratase [Mycobacterium smegm
Sequence MLDGVLFFPVTPFTASGDVDVDLLAQHVARGVEAGPGGVFIGCGTGEFHA
LEPEEMRTVVRTAVDAAAGRVPVYAGAGGPVASAKAFARVAAESGADGLL
LLPPYLVEMPQAGLVGYTRAVSAVTDLPLVVYNRNNARFTEGSAIEVAKL
PNVVGFKDGTGDFDQVARIVRAVTDALEPEGKPFQFFNGLPTAEVSQQAY
RAIGVTLYSSATFAFAPDVSLAFYQALEDGKEPLVAALLRSFFHPLVRLR
NKVPGYAVSLIKAGVTLGGLQAGPVRPPLIDAAPDDVDELQRILSAGRAV
LADALVH
gene ID441216513
StrainM_smegmatis_MKD8
Protein IDZP_20977033.1
Description putative 5-dehydro-4-deoxyglucarate dehydratase [Mycobacterium smegm
Sequence MLDGVLFFPVTPFTASGDVDVDLLAQHVARGVEAGPGGVFIGCGTGEFHA
LEPEEMRTVVRTAVDAAAGRVPVYAGAGGPVASAKAFARVAAESGADGLL
LLPPYLVEMPQAGLVGYTRAVSAVTDLPLVVYNRNNARFTEGSAIEVAKL
PNVVGFKDGTGDFDQVARIVRAVTDALEPEGKPFQFFNGLPTAEVSQQAY
RAIGVTLYSSATFAFAPDVSLAFYQALEDGKEPLVAALLRSFFHPLVRLR
NKVPGYAVSLIKAGVTLGGLQAGPVRPPLIDAAPDDVDELQRILSAGRAV
LADALVH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo