Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216551
StrainM_smegmatis_MKD8
Protein IDZP_20977071.1
Description 2-dehydro-3-deoxy-6-phosphogalactonate aldolase [Mycobacterium smegm
Sequence MNQPTGLVAILRGVRPDEILAIGGALIDAGFTAIEIPLNSPDPFDSIERL
AAAAPEGCVIGAGTVLTVDDVVRAESAGARIMVSPNANPEVIAAATRRGM
RAYPGVATPTEAFSAVDAGARSLKLFPSDAVGISGMKAWRAVLPADVEML
PVGGVDENNLADWIAAGADGAGLGTNLYRPGDDAAEVARRARTLQDIWSD
AYAERNPR
gene ID441216551
StrainM_smegmatis_MKD8
Protein IDZP_20977071.1
Description 2-dehydro-3-deoxy-6-phosphogalactonate aldolase [Mycobacterium smegm
Sequence MNQPTGLVAILRGVRPDEILAIGGALIDAGFTAIEIPLNSPDPFDSIERL
AAAAPEGCVIGAGTVLTVDDVVRAESAGARIMVSPNANPEVIAAATRRGM
RAYPGVATPTEAFSAVDAGARSLKLFPSDAVGISGMKAWRAVLPADVEML
PVGGVDENNLADWIAAGADGAGLGTNLYRPGDDAAEVARRARTLQDIWSD
AYAERNPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo