Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216574
StrainM_smegmatis_MKD8
Protein IDZP_20977094.1
Description transcriptional regulatory protein Whib-like WhiB4 [Mycobacterium sm
Sequence MSQARCRQADPDELFVRGAAQRKAAVICRHCPVILECGADALDNRVEFGV
WGGMTERQRRALLKQHPEVSSWADFFAAQRKHRSAV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo