Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216677
StrainM_smegmatis_MKD8
Protein IDZP_20977119.1
Description putative sensor kinase [Mycobacterium smegmatis MKD8]
Sequence MVITGALTTTVVATVVGPPLFREHLHQAGVPPDSMEEVHAEEAYGYATVI
SIGVAVAVSALVALAVSYYVSRRLQRSVTEVAAAAKAVANGHYDTRVSPP
QLGDDFDALAVAFNQMASRLQTVDSTRQRLFGDLAHEIRTPVAVLEAYIE
ALEDGVRTLTPATAAMLRDQTRRLVRFSQDVAALAKAEESSFSLAHNTID
VGTVARRCIAAAQERYDTKGVAITLHQNQPLPALWADEQRLAQVIGNLLD
NALLHTAPGGSVELTCTHDGSNVVITVADDGEGIAEEHLPRIFERFYRAD
AARDRGHGGAGLGLAIAKALVEAHGGTIAVASAGPGTGATFTVELPVTPV
RGAADGHTAN
gene ID441216677
StrainM_smegmatis_MKD8
Protein IDZP_20977119.1
Description putative sensor kinase [Mycobacterium smegmatis MKD8]
Sequence MVITGALTTTVVATVVGPPLFREHLHQAGVPPDSMEEVHAEEAYGYATVI
SIGVAVAVSALVALAVSYYVSRRLQRSVTEVAAAAKAVANGHYDTRVSPP
QLGDDFDALAVAFNQMASRLQTVDSTRQRLFGDLAHEIRTPVAVLEAYIE
ALEDGVRTLTPATAAMLRDQTRRLVRFSQDVAALAKAEESSFSLAHNTID
VGTVARRCIAAAQERYDTKGVAITLHQNQPLPALWADEQRLAQVIGNLLD
NALLHTAPGGSVELTCTHDGSNVVITVADDGEGIAEEHLPRIFERFYRAD
AARDRGHGGAGLGLAIAKALVEAHGGTIAVASAGPGTGATFTVELPVTPV
RGAADGHTAN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo