Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441216899
StrainM_smegmatis_MKD8
Protein IDZP_20977179.1
Description aspartate kinase- monofunctional class [Mycobacterium smegmatis MKD8
Sequence MALVVQKYGGSSVADAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDL
LDLARQVSPAPPPREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQA
GVITTGTHGNAKIIDVTPGRLRDALDEGQIVLVAGFQGVSQDSKDVTTLG
RGGSDTTAVAVAAALDADVCEIYTDVDGIFTADPRIVPNARHLDTVSFEE
MLEMAACGAKVLMLRCVEYARRYNVPIHVRSSYSDKPGTIVKGSIEDIPM
EDAILTGVAHDRSEAKVTVVGLPDVPGYAAKVFRAVAEADVNIDMVLQNI
SKIEDGKTDITFTCARDNGPRAVEKLSALKSEIGFSQVLYDDHIGKVSLI
GAGMRSHPGVTATFCEALAEAGINIDLISTSEIRISVLIKDTELDKAVSA
LHEAFGLGGDDEAVVYAGTGR
gene ID441216899
StrainM_smegmatis_MKD8
Protein IDZP_20977179.1
Description aspartate kinase- monofunctional class [Mycobacterium smegmatis MKD8
Sequence MALVVQKYGGSSVADAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDL
LDLARQVSPAPPPREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQA
GVITTGTHGNAKIIDVTPGRLRDALDEGQIVLVAGFQGVSQDSKDVTTLG
RGGSDTTAVAVAAALDADVCEIYTDVDGIFTADPRIVPNARHLDTVSFEE
MLEMAACGAKVLMLRCVEYARRYNVPIHVRSSYSDKPGTIVKGSIEDIPM
EDAILTGVAHDRSEAKVTVVGLPDVPGYAAKVFRAVAEADVNIDMVLQNI
SKIEDGKTDITFTCARDNGPRAVEKLSALKSEIGFSQVLYDDHIGKVSLI
GAGMRSHPGVTATFCEALAEAGINIDLISTSEIRISVLIKDTELDKAVSA
LHEAFGLGGDDEAVVYAGTGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo