Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217133
StrainM_smegmatis_MKD8
Protein IDZP_20977316.1
Description putative hydrolase AcbJ [Mycobacterium smegmatis MKD8]
Sequence MTSDKTPGLIATDVDGTLLDEDERVTPRTRAAVRAAVAAGATFVLATGRP
PRWIQPVVDGLGLAPMAVCANGAVIYDPATDRIVSARTLSPEMLAELADI
ATHVIPGAGLAVERVGRSAHDAATPQFVSSPGYEHAWLNPDNTEVSVEDL
LSAPAVKLLIRKAGAQSADMAAELVKHIGAQGDITYSTNNGLIEIVPSGI
SKATGVAELAGPLGLTDADIVAFGDMPNDVPMLSWAGRGVAMGNAHPEAK
AAADEVTTTNAEDGVATVLERWWG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo