Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217135
StrainM_smegmatis_MKD8
Protein IDZP_20977318.1
Description 1-acylglycerol-3-phosphate O-acyltransferase [Mycobacterium smegmati
Sequence MEPVYGTVIQLARLAWRLQGLKFTVTGVENLPVTGGAVVAINHTSYFDFT
FAGLPAYLQKRGRKVRFMAKKEVFDNKITGPIMRSLRHIEVDRHSGAASF
EQACEYLKVGELVGVYPEATISRSFEIKELKSGAARMAIEADVPIIPHIV
WGAQRIWTKGRPKNLYRPKVPIFIAVGEPIAPTLPAPELTALLHSRMQHL
LEQVQDSYGPHPAGEFWVPHRLGGGAPSLAEANLMDAEEAAEKAARRAKQ
SGSGPAEPSGAPG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo