Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217678
StrainM_smegmatis_MKD8
Protein IDZP_20977352.1
Description 2-demethylmenaquinone methyltransferase [Mycobacterium smegmatis MKD
Sequence MSIEPRATADLVDDIYPDVRSCDLQLQNYGGKIKFAGPVTTVRCFQDNAL
LKSILSTPGEGGVLVVDGAGSLHTALVGDVIAGLAADNGWSGVIVNGAVR
DAAALRTIDVGIKALGTNPRKGTKTGEGERDVEVSFGGVTFTPGDIAYCD
EDGIVVVTP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo