Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441217725
StrainM_smegmatis_MKD8
Protein IDZP_20977399.1
Description aminocarboxymuconate-semialdehyde decarboxylase [Mycobacterium smegm
Sequence MITAPLAGGVIDVHAHWLPRELFDLPPGAPYGPLHDRDGQLHLGDLPLSI
ATDAMSDEAAIIDDMDRAGVGVRVLSAPPFAFPLRGGDDADRYAAEFNQA
LAKLVARGDGRLAGLGIVSLDAGPDFASGSVPRQLDHLAAVDGIAGVAIP
PVVDGRSFDGAALRHVLTEAARRDLAVLVHPMQIGRAEWSQFYLANLIGN
PVETATAVATLILSGLQEELPDLRICFLHGGGCAPGLLGRWSHGWTARAD
VRSRTSRPPAEAFRRLYFDTITHGVPQLELLTELAGEDRIVCGSDYPFDM
AEVDPARFAVEHGPGQDSLIRAARVFLGIREARAGDTINPYRNPSATPVL
APDAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo