Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218026
StrainM_smegmatis_MKD8
Protein IDZP_20977493.1
Description putative pyridoxine/pyridoxamine 5'-phosphate oxidase [Mycobacterium
Sequence MTATSSDAFDPRSLLAEARIGVLATIKANGLPQLSPVTPYYDRAADIIYV
SMTDGRAKTANLRRDPRAALEVTRADGWAWATAEGTVTLTGPGTDPHGPE
VEALVEYYRKAAGEHPDWDEYRSVMVSDRRVLMKLSVQRVYGERLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo