Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218350
StrainM_smegmatis_MKD8
Protein IDZP_20977557.1
Description permease- cytosine/purine- uracil- thiamine- allantoin family protei
Sequence MSATATGTPLPGTTESLESDLTVIPESSRTTDVRGQFWIWAGANIAPINW
ILGALGVSMGLGLFETIAVLAVGNAIGMSLFGTFVVIGQRTGVTGMVLSR
AVFGRRGAYVPAAVQAVVCMGWCAVNTWIVLDLVMALLGRVGIVDPDNAS
AAPRILVAAIIMVIQVVIAWFGYRVIATFERWTVPPTVAVLVAMTLVAWF
GLDVDWGYSGDATLTTTEHIAALSAVMTAIGIGWGITWLGYAADYSRFVS
TSVPSRKLFTVSALGQFIPVIWLGALGATLATLSTSTDPGEIIVDAYGAL
AIPVLLLVVHGPLATNILNIYTCTVSTQALDIHINRRVLNVVIGVVAMAI
VVVFVLNGDFASTIDAWLVGIVGWLSPWAAVMLVHYFFIARRQVDAEALV
TPPEARLLPMVRPTALVALAIGVVCTWMFMYGMIPLLQGPAALALGGVDL
SWLAGGLTAGISYLALEAVRTRRTTVSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo