Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218378
StrainM_smegmatis_MKD8
Protein IDZP_20977585.1
Description L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium
Sequence MSAAALEGVVVADFSRVLAGPYATMMLADFGAEVIKIERPGTGDDTRQWG
PPYDSTGVATYFNSVNRNKRSVALDLGSTEGREQARELIRRADIVVENFR
PGTMEKLGLGYDDVRAIRPDVIYCSITGFGHGGGAALPGYDLLVQAVGGL
MSVTGTEPGDPTKAGVALVDVLAGMHALSGILVALAHRDRTGEGQRVDTN
LFSVLLSSMVNQASGYLGAGVVPGIMGNRHPSITPYQTFDTADRPIAIAV
GNDKQFRAFAAVIGSPELADDPRFSTNPQRVAHRDVLCPLIEAALKAKGA
DHWYHELTAVGVPAGPINDLSEAFAFAEELGIEAVVQMPDGPTPQVANPI
TLSATPVTYRNSPPPLS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo