Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218472
StrainM_smegmatis_MKD8
Protein IDZP_20977679.1
Description ribose transport system permease protein rbsC [Mycobacterium smegmat
Sequence MGTLLREPLVGPLVALVIAIIVFSSISNSFLNPQNVSLILQQSVVVGILA
VGQTLIILTAGIDLSIGAVAVFGTIVMAQTAGSGGPFLALGATLLVCVAF
GAINGGLVTTLRLPPFIVTLGTFTAILAGTRLLAGSETYRVEPGPLTFLG
TSFRIGSFSTTYGVVAMLLVYAVVWYALSQTAWGKHVYAVGGNPQSADLL
GVKSGRVLFSVYLVTGVIAAIAAWAALGRIPNADPNAYQNANLETITAVV
IGGTSLFGGRGGVGGTLVGMLIVAVLRNGLTQAGVDSLYQNIATGILVIV
AVAVDQFARRRSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo