Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218508
StrainM_smegmatis_MKD8
Protein IDZP_20977715.1
Description gentisate 1 2-dioxygenase-like protein [Mycobacterium smegmatis MKD8
Sequence MNGEIALAHLDVANLPSMKPFRFHNDTREVWARLSYSNAPLLEKLGVHYA
EDVPTWTGPGTVVPTATAAAEAALYTRSTAPDARVAAVTGTPPSRSTTTS
RDPG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo