Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218556
StrainM_smegmatis_MKD8
Protein IDZP_20977763.1
Description TRAP-T family tripartite ATP-independent periplasmic transporter- bi
Sequence MTAQIRRPTAFSRRTALKAGAAAAASLAAVPLAACGIGGSGTGAQHRFRL
AETHPENYPTTLGDKRFADLVRERSGGRIDIQVYAGGRLGEESDIIEQVQ
LGVIEMTRVSSAPMAEFAGPMGLFGLPFIFDDADHMWRFLDAEDGGRKLL
GELDRAGFKGLCYFDPGARSFYTTDRVITTPEDVRGLKFRVQQAAVIMDF
ISALGGSPTPMNYGEVYSSLQSGLLDGAENNAPSYFTASHYEVAPNFTLD
EHMRVAEILIVNRSVWEDLPTEDQNLLQQAAFDAVPYQRKKWNEQVDADM
QKLREAGVTITRVDDIAPWRAATKSVIDKYGEQYAEYLDRIAALRRSDRP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo