Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218576
StrainM_smegmatis_MKD8
Protein IDZP_20977783.1
Description bacterial transcriptional regulator family protein [Mycobacterium sm
Sequence MKVLDVLAALSERGGCHRIVDLAARTELPKATVYRLLQHLVSQGFVVAEP
DSTYRIGPRFLGIAAAALSDAPWRKTVAAALESLRTATGLSAHFAQQYGG
NLVIVDAVESLDPFAIPVRPGLTTAIEQTALGQAIVSTSSEAVVSQDPAR
QLRWVAAPVFHRRGEVLGALGVAGTDFTLADQALDRVRAVVRSAAADASA
VLTAPSFGHRGTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo