Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218622
StrainM_smegmatis_MKD8
Protein IDZP_20977829.1
Description phosphate ABC superfamily ATP binding cassette transporter- ABC prot
Sequence MPAPDAVSLTATNIHLAFGPNKVLRGVDLDVPAGTTTAVIGPSGSGKSTL
LRTLNRLYEPDEGDVLLDGRSVLRDNPDQLRQRIGMVFQQFNLFPHRSVL
DNVTLGPRKLKGLGADDARELGLAQLDRVGLRHKADVRPGTLSGGQQQRV
AIARALAMAPQVMFFDEATSALDPELVKGILSLMADLAADGMTIVAVTHE
MGFARSTANTVVFMDQGRVVESGEPDQLFEAAETDRLRRFLSQVL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo