Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID443493459
StrainM_liflandiii_128FXT
Protein IDYP_007371606.1
Description Esat-6 like protein EsxB [Mycobacterium liflandii 128FXT]
Sequence MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQAQWRGAAGTA
AQAAVVRFQEAANKQKAELDEISTNIRQAGVQYSRADDEQQQALSSQMGF
B cell epitope (IEDB)15
T cell epitope (IEDB)162
MHC binder (IEDB)234
Vaccine TargetYes
B cell prediction (LBtope)18
MHC class II prediction (Propred)27
MHC class 1 prediction (Propred1)169
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)90
Prediction of IL4 inducing peptides (IL4pred)202