Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449062659
StrainM_bovis_BCG_str_Korea
Protein IDYP_007429742.1
Description methoxy mycolic acid synthase 4 [Mycobacterium bovis BCG str. Korea
Sequence MGAQPPVTDTIQENMTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQ
DPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGT
TMRRAVERLDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFA
EPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEM
AARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLS
LRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEM
LDCSLVTYLKPGAAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)221
CTL epitope prediction (CTLpred)52
Prediction of interferon-gamma inducing peptides (IFNepitope)100
Prediction of IL4 inducing peptides (IL4pred)247