Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449063957
StrainM_bovis_BCG_str_Korea
Protein IDYP_007431040.1
Description hypothetical protein K60_019820 [Mycobacterium bovis BCG str. Korea
Sequence MIRELVTTAAITGAAIGGAPVAGADPQRYDGDVPGMNYDASLGAPCSSWE
RFIFGRGPSGQAEACHFPPPNQFPPAETGYWVISYPLYGVQQVGAPCPKP
QAAAQSPDGLPMLCLGARGWQPGWFTGAGFFPPEP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)2
MHC class II prediction (Propred)13
MHC class 1 prediction (Propred1)79
CTL epitope prediction (CTLpred)9
Prediction of interferon-gamma inducing peptides (IFNepitope)51
Prediction of IL4 inducing peptides (IL4pred)95