Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449063999
StrainM_bovis_BCG_str_Korea
Protein IDYP_007431082.1
Description thiol peroxidase [Mycobacterium bovis BCG str. Korea 1168P]
Sequence MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLN
IFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTEN
VMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEI
AQEPNYEAALAALGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)109
CTL epitope prediction (CTLpred)23
Prediction of interferon-gamma inducing peptides (IFNepitope)68
Prediction of IL4 inducing peptides (IL4pred)83