Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449064516
StrainM_bovis_BCG_str_Korea
Protein IDYP_007431599.1
Description nucleoside diphosphate kinase ndkA [Mycobacterium bovis BCG str. Ko
Sequence MLGTVTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELA
SQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQ
AAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)88
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)58
Prediction of IL4 inducing peptides (IL4pred)89