Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449065021
StrainM_bovis_BCG_str_Korea
Protein IDYP_007432104.1
Description acyl-CoA synthetase [Mycobacterium bovis BCG str. Korea 1168P]
Sequence MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLN
VARELSRCGSTGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVT
DERSDSVLSDSSPVAILTTSSAVDDVVQHVARRPGESPPSIIEVDLLDLD
APNGYTFKEDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNFEQLMSGYF
ADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQR
PARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETV
DFDTESLSAGHAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTV
GEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFV
TDGKMFIIGRIKDLLIVYGRNHSPDDIEATIQEITRGRCAAISVPGDRST
EKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGLSVADLVLVAP
GSIPITTSGKVRRGACVEQYRQDQFARLDA
B cell epitope (IEDB)2
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)37
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)382
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)215
Prediction of IL4 inducing peptides (IL4pred)419