Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID449065994
StrainM_bovis_BCG_str_Korea
Protein IDYP_007433077.1
Description hypothetical protein K60_040190 [Mycobacterium bovis BCG str. Korea
Sequence MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVV
AVLILAGAALLAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTS
ARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLC
DTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTT
KGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAA
GAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRAT
QAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQR
SAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSP
DPRYTESMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPV
LSKDAALLEHDTLPADPSPRKVPAGASGAP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)34
MHC class II prediction (Propred)85
MHC class 1 prediction (Propred1)318
CTL epitope prediction (CTLpred)58
Prediction of interferon-gamma inducing peptides (IFNepitope)154
Prediction of IL4 inducing peptides (IL4pred)315