This page list peptide entries having specific modifications (terminal/chemical modifications) as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).
S-ID: Sequence ID; Seq: Sequence; Cter: C-terminal Modifications; Nter: N-terminal Modifications; Mod: Chemical/Non-Natural Modifications;
The total number of entries retured by search is 219| S-Id | Sequence (Seq) | Cter | Nter | Mod |
|---|---|---|---|---|
| satpdb17385 | ELALELALEALEAALELA | Amidation | Labelled with fluorescein | None |
| satpdb17571 | ERKKRRRE | Amidation | Labelled with fluoresceine | None |
| satpdb17712 | PFVYLI | Amidation | Labelled with fluoresceine/FITC | None |
| satpdb17755 | LLIILRRRARKQAHAHSK | Amidation | Labelled with fluorescein | None |
| satpdb17798 | GRKKRRQRRRPWQ | Amidation | Labeled with fluorescein | None |
| satpdb18019 | LKTLTETLKELTKTLTEL | Amidation | Labelled with fluorescein | None |
| satpdb18514 | AGYLLGKINLKALAALAKKIL | Amidation | Labelled with fluoresceine at amino group of lysin | None |
| satpdb18530 | KLPVM | Free | Labelled with fluorescein | None |
| satpdb18588 | AHALCPPERQIKIWFQNRRMKWKKEN | Free | Labelled with fluorescein | None |
| satpdb18661 | KLWMRWYSPWTRRYG | Free | Labelled with fluorescein | None |
| satpdb18723 | FRVPLRIRPCVVAPRLVMVRHTFGRIARWV AGPLETR | Amidation | Labelled with fluorescein | None |
| satpdb18758 | rkkrrqrrr | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb18981 | TSPLNIHNGQKL | Amidation | Labelled with fluoresceine/ FITC/texas red | None |
| satpdb19030 | VPALR | Free | Labelled with fluorescein | None |
| satpdb19365 | RLWMRWYSPWTRRYG | Free | Labelled with fluorescein | None |
| satpdb19390 | QLALQLALQALQAALQLA | Amidation | Labelled with fluorescein | None |
| satpdb19541 | LLAILRRRIRKQAHAHSK | Amidation | Labelled with fluorescein | None |
| satpdb19576 | CSIPPEVKFNPFVYLI | Amidation | Labelled with fluoresceine/FITC | None |
| satpdb19615 | RKKRAQRRR | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb19618 | lliilrrrirkqahahsk | Amidation | Labelled with fluorescein | None |
| satpdb19682 | VRRFLVTLRIRRA | Amidation | Labelled with fluorescein | None |
| satpdb19823 | MVTVLFRRLRIRRACGPPRVRV | Amidation | Labelled with fluoresceine | None |
| satpdb19866 | RLWMRWASPTTRRYG | Free | Labelled with fluorescein | None |
| satpdb19988 | SKKKKTKV | Amidation | Labelled with fluoresceine | None |
| satpdb20020 | KLALKLALKALKAALKLA | Amidation | Labelled with fluorescein | None |
| satpdb20045 | RKKRRQRRR | Free | Labelled with fluorescein | None |
| satpdb20099 | LLIILRRRIRKQAHAHSA | Amidation | Labelled with fluorescein | None |
| satpdb20221 | QQHLLIAINGYPRYN | Free | Labelled with fluorescein | None |
| satpdb20358 | DFNKFHTFPQTAIGVGAP | Amidation | Labelled with fluoresceine | None |
| satpdb20380 | RQIKIWFPNRRMKWKK | Amidation | Labeled with fluorescein | None |
| satpdb20388 | rrrqrrkkr | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb20607 | KKAAQIRSQVMTHLRVI | Amidation | Labelled with fluoresceine | None |
| satpdb20737 | RRRRRR | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb20767 | LLIILRRRIRKQAHAHSK | Amidation | Labelled with fluorescein | None |
| satpdb20809 | RRRRR | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb20823 | PPRLPRPRPRPLPFPRPG | Free | Labelled with fluorescein | None |
| satpdb20896 | RQIKIWFQNRRMKWKK | Amidation | Labelled with fluoresceine | None |
| satpdb21015 | RAKRRQRRR | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb21068 | IAWVKAFIRKLRKGPLG | Amidation | Labelled with fluoresceine | None |
| satpdb21095 | MVKSKIGSWILVLFVAMWSDVGLCKKRPKP | Amidation | Labelled with fluoresceine | None |
| satpdb21153 | PRPRPLPFPRPG | Free | Labelled with fluorescein | None |
| satpdb21185 | rqikiwfqnrrmkwkk | Amidation | Fluorescein labelled | None |
| satpdb21293 | LLIILRRRIRKQAHAHAK | Amidation | Labelled with fluorescein | None |
| satpdb21403 | RLIMRIYSPTTRRYG | Free | Labelled with fluorescein | None |
| satpdb21547 | RKKARQRRR | Free | Labelled with fluorescein with aminohexanoic space | None |
| satpdb21654 | IPSRWKDQFWKRWHY | Free | Labelled with fluorescein | None |
| satpdb21672 | MVRRFLVTLRIRRACGPPRVRV | Amidation | Labelled with fluorescein | None |
| satpdb21780 | VPMIK | Free | Labelled with fluorescein | None |
| satpdb21824 | VKLPPPVKLPPPVKLPPP | Free | Labelled with fluoresceine | None |
| satpdb22015 | RQIKIWFQNRRMKWKK | Amidation | Labelled with fluorescein | None |