Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Positive charged residues between 51-75%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 243

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb25619	RWGRWLRKIRRWRPK	15	40	53	53	0	13
satpdb25651	RLYRRLYRK	9	44	78	56	0	0
satpdb25742	KRFKKFFKKLK	11	36	64	64	0	0
satpdb25896	KWKKLLKKLLKLPKKLLKKLKKLLK	25	48	52	52	0	4
satpdb26070	KRAKKFFKKPK	11	36	64	64	0	18
satpdb26150	GRKKRRQRRRPPQC	14	14	71	57	0	29
satpdb26161	KLKLKLKLKLK	11	45	55	55	0	0
satpdb26175	KRFRIRVRVIRK	12	42	58	58	0	0
satpdb26600	KRIPNKKPGKK	11	27	64	55	0	27
satpdb26630	GRKKRRQRRRC	11	0	82	73	0	18
satpdb26668	YGRKKRRQRRRGCYGRKKRRQRRRG	25	8	80	64	0	20
satpdb26721	RRHHCRSKAKRSR	13	23	85	54	0	31
satpdb26854	RLRLRIGRR	9	33	56	56	0	11
satpdb26856	RRWRRWWRRWWRRWRR	16	38	63	63	0	0
satpdb26867	TRQARRNRRRRWRERQRGC	19	11	79	53	5	21
satpdb26942	AKKAWKKAKKAAKKAKKWAKK	21	43	57	57	0	33
satpdb26965	KRIPNKKPKK	10	30	70	60	0	20
satpdb27007	NRRMKWKK	8	13	75	63	0	0
satpdb27053	GRFKRFRKKFKKLFKKLS	18	33	61	56	0	11
satpdb27059	PKKKRKV	7	29	71	71	0	14
satpdb27173	TLISWIKNKRKQRPRVSRRRRRRGGRRRRC	30	20	70	53	0	23
satpdb27246	KKLFKKILKKL	11	45	55	55	0	0
satpdb27458	RGRKSSRRKK	10	0	90	70	0	30
satpdb27460	IGKKFKRIVKRIKKWLRKL	19	42	53	53	0	5
satpdb27539	YGRKKRRQRRR	11	9	91	73	0	9
satpdb27617	KGRGKRRREKQRPSDKP	17	12	76	53	12	29
satpdb27724	RQARRNRRRC	10	10	80	60	0	20
satpdb27850	WGRKKRRQRRRPPQ	14	21	71	57	0	21
satpdb27853	KKWlKLKlKlKK	12	42	58	58	0	0
satpdb27854	GRfKRfRKKfKKLfKKLS	18	33	61	56	0	11
satpdb27889	CGKRKKKGKLGKKRPRSR	18	11	67	61	0	33
satpdb27898	RRWQWRMKK	9	22	67	56	0	0
satpdb27919	AKK	3	33	67	67	0	33
satpdb28016	GKKLLKKLKKLLKKG	15	33	53	53	0	13
satpdb28194	LRLKKRRWKYRV	12	42	67	58	0	0
satpdb28196	LKKLLKKLKKL	11	45	55	55	0	0
satpdb28417	TRRQRTRRARRNRGC	15	7	80	53	0	33
satpdb28767	KKklKKLkKkLK	12	25	75	75	0	0
satpdb28837	KLKLKLKLKLKLKLK	15	47	53	53	0	0
satpdb28920	TWLKKRRWKKAK	12	33	67	58	0	17
satpdb29033	GKKLLKKWKKLWKKW	15	40	53	53	0	7
satpdb29073	KLKLKLKLK	9	44	56	56	0	0
satpdb29194	kkwkmrrGaGrrrrrrrrr	19	11	74	74	0	16

entries from 201 - 250