Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Polar residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 2686

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb10337	FA	2	100	0	0	0	50
satpdb10339	ILPFLAGLFSKIL	13	77	15	8	0	31
satpdb10340	GCVLLPWC	8	63	0	0	0	50
satpdb10353	GCLDPGYFCGTPFLGAYCCGGICLIVCIET	30	47	20	0	7	57
satpdb10354	ACPC-L-APC-K-APC-L-ACPC-K-APC- L-ACPC-L-ACPC-L-ACPC	50	42	4	4	0	58
satpdb10356	ILPWKWPWWPWRR	13	77	23	23	0	23
satpdb10380	GGWGQAGGWGKLFS	14	36	21	7	0	57
satpdb10392	LPFEF	5	80	20	0	20	20
satpdb10393	GWMDF	5	40	20	0	20	20
satpdb10398	AVIPPLRCKAVFC	13	69	15	15	0	46
satpdb10400	CQLAAVC	7	57	14	0	0	57
satpdb10416	FLPVLAGLTPSIVPKLVCLLTKKC	24	63	25	13	0	42
satpdb10419	GPMGWVPVFYRF	12	67	17	8	0	33
satpdb10422	MBP:LAAWFCLW	12	67	0	0	0	33
satpdb10423	MLLCS	5	40	20	0	0	40
satpdb10424	PFSLIPHAIGGLISAIK	17	71	24	6	0	47
satpdb10426	VVPPFIQPE	9	78	22	0	11	33
satpdb10431	FLPAIAGILSQLF	13	77	15	0	0	38
satpdb10437	DCQALWDYCPVPLLSSGDCCYGLICGPFVC IGW	33	52	24	0	9	48
satpdb10439	FLGGLLFGIFKHLGKK	16	56	25	19	0	25
satpdb10440	FFLPPCAHKGTC	12	58	25	8	0	58
satpdb10448	QGILRAGPAIALVGDARAVG	20	60	20	10	5	50
satpdb10453	LIGPVLGLVGSALGGLLKKI	20	60	15	10	0	40
satpdb10457	FFPLLFGALSSMMPKLFGK	19	58	21	11	0	37
satpdb10460	FFPIVGKLLFGLFGL	15	73	7	7	0	27
satpdb10461	FLAGLIGGLAKMLGK	15	53	13	13	0	40
satpdb10469	ALCCYGYRFCCPIF	14	57	21	7	0	50
satpdb10484	MLPKPSSFPVPG	12	58	25	8	0	58
satpdb10496	WVLVLRlGY	9	78	22	11	0	11
satpdb10499	FFLPSLIGGLISAIK	15	67	20	7	0	40
satpdb10521	VRGPFPIIV	9	78	11	11	0	33
satpdb10541	FLPMLAGLAANFLPKIVCKITKKC	24	58	25	17	0	38
satpdb10547	FLPIIAKLLGGL	12	75	8	8	0	33
satpdb10559	GFWGKLFKLGLHGIGLLHLHL	21	67	24	10	0	24
satpdb10566	FLPLFLPKIICVITKKC	17	65	24	18	0	29
satpdb10569	AAYFLLKLAGRW	12	75	25	17	0	33
satpdb10570	FISAIASMLGKFL	13	62	23	8	0	38
satpdb10579	LLPIVGKLLSGL	12	67	17	8	0	33
satpdb10582	VLIVP	5	100	0	0	0	20
satpdb10590	VGALAVVVWLYLWLW	15	93	7	0	0	20
satpdb10607	IPALK	5	80	20	20	0	40
satpdb10624	KWΔFWKΔFVKΔFAK	17	41	24	24	0	6
satpdb10628	ILPWKWPWWPWRR	13	77	23	23	0	23
satpdb10647	LCPKHPLGC	9	56	22	11	0	56
satpdb10667	CIPHFDPCDPIRHTCCFGLCLLIACI	26	58	23	4	8	46
satpdb10671	VLLN-Fum-GGF	12	42	8	0	0	17
satpdb10679	KCOwSPWC	8	38	25	13	0	50
satpdb10681	QLPVM	5	60	20	0	0	20
satpdb10701	FLPIIGQLLSGLL	13	69	15	0	0	31
satpdb10702	GLLGVLGSVAKHVLPHVVPVIAEHL	25	76	24	4	4	32

entries from 51 - 100