Output of option Peptide Property of Browse Menu

This page list peptide entries having specific physico-chemical properties as selected by the user. The header of the table has abbreviations which are explained just above the starting of the table. Moreover, each column of the table can be sorted by clicking on the header of that column. Clicking once will display the results in descending order while clicking twice will display in ascending order. For example, if a user wants to get peptide sequences having maximum length (column 'Len') then he/she needs to sort 'Len' column by cliking on 'Len' header. User may get detailed information about a peptide by clicking its ID (left column labeled S-ID).

Search results of property wise browsing (Polar residues between 0-25%)

S-ID: SATPdb ID; Seq: Sequence; Len: Length; HR: (%)Hydrophobic Residues; PR: (%)Polar Residues; Pos:(%) Positive Residues; Neg:(%) Negative Residues; SS:(%) Small size Residues;

The total number of entries retured by search is 2686

S-ID	Sequence	Len	HR	PR	Pos	Neg	SS
satpdb11688	FFPIVGKLLFGLFGLL	16	75	6	6	0	25
satpdb11691	AIKWEYVLLLFLL	13	85	23	8	8	8
satpdb11692	KPVAL	5	80	20	20	0	40
satpdb11694	AW	2	100	0	0	0	50
satpdb11702	FLPFVGKLLSGLL	13	69	15	8	0	31
satpdb11706	SLVLPVPE	8	75	25	0	13	38
satpdb11708	ILGPVVGLVGNALGGLLKNL	20	60	15	5	0	35
satpdb11716	I/LLGTILGLLKGI/L	16	56	13	6	0	25
satpdb11720	Z-(F)FG	7	29	0	0	0	14
satpdb11721	FLGALLSAGATILPSLICKIFKKC	24	58	25	13	0	46
satpdb11723	FLPIVGKLLSGLF	13	69	15	8	0	31
satpdb11735	ACRKKWEYCIVPIIGFIYCCPGLICGPFVC V	31	58	19	10	3	42
satpdb11746	LPF	3	100	0	0	0	33
satpdb11754	GLLGPLLKIAAKVGKKLL	18	61	22	22	0	33
satpdb11755	FLPLLVGAISSILPKIF	17	76	18	6	0	35
satpdb11764	FCCPFIRYCCW	11	55	18	9	0	45
satpdb11777	FLPLIGKILGTILGK	15	60	20	13	0	33
satpdb11778	FLPILAGLAAKIVPKLFCLATKKC	24	67	21	17	0	42
satpdb11792	GIFGKILGAGKKVLCGLSGLC	21	43	19	14	0	48
satpdb11800	ILPLKLPWLPLRR	13	77	23	23	0	23
satpdb11817	EVEGPQVGALELAGGPGAGGLEGPPQ	26	46	23	0	15	58
satpdb11839	DCCPAKLLCCNP	12	42	25	8	8	58
satpdb11856	ILPILSLIGGLLGK	14	64	14	7	0	36
satpdb11858	I-Cha-C	7	43	14	0	0	43
satpdb11860	VIF	3	100	0	0	0	0
satpdb11865	GFGMALKLLKKVL	13	54	23	23	0	23
satpdb11867	VCCPFGDCHEICYCCG	16	38	25	0	13	56
satpdb11869	GIISGLLGAGKKIVCGLSGLC	21	43	19	10	0	52
satpdb11870	RVCYAIPLPIC	11	73	18	9	0	45
satpdb11874	AVGIGAMFLGFLGAAGSTMGAAS	23	52	13	0	0	65
satpdb11875	GCCPPQWCGPDCTSPCC	17	29	24	0	6	82
satpdb11884	EGGGPQWAVGHFM	13	46	23	0	8	46
satpdb11889	FLPIASLLGKYL	12	75	25	8	0	33
satpdb11900	RRKKAAVAELPAVLLALLAP	20	75	25	20	5	40
satpdb11903	LLPIVGKLLSGLL	13	69	15	8	0	31
satpdb11905	ALP	3	100	0	0	0	67
satpdb11917	FFPALISCVVLKDC	14	64	21	7	7	36
satpdb11926	GLLGSIFGAGKKIACALSGLC	21	48	19	10	0	57
satpdb11939	GCCEDGWCCTAAP	13	31	23	0	15	77
satpdb11946	GLFGILGSVAKHVLPHVIPVVAEHL	25	76	24	4	4	32
satpdb11948	EVLP	4	75	25	0	25	25
satpdb11960	GIFGKILGVGKKVLCGLSGMC	21	38	19	14	0	43
satpdb11982	VAKALAKALLKALKAL	16	75	25	25	0	38
satpdb12000	LIILVPPfF	9	100	0	0	0	22
satpdb12005	ILGPVLGLVGNDLEVYLKIL	20	65	25	5	10	20
satpdb12009	LLPILGNLLNGL	12	67	17	0	0	25
satpdb12011	FGLPMLSILPKALCILLKRKC	21	57	24	19	0	33
satpdb12012	GLLDALSGILGL	12	58	17	0	8	42
satpdb12015	ILPILGNLLNGLL	13	69	15	0	0	23
satpdb12024	LVTLVFV	7	86	14	0	0	14

entries from 251 - 300