Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID12693 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.984 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 0.925 fold change" | 27058005 |
| CancerPDF_ID12694 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2326.204 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.58 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.217 fold change" | 27058005 |
| CancerPDF_ID12695 | HRIHWE | Complement C3 | Serum | 877.0667 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.065 fold change" | 27058005 |
| CancerPDF_ID12696 | IHWESASLL | Complement C3 | Serum | 1055.082 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.21 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.27, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12697 | SSKITHRIH | Complement C3 | Serum | 1078.125 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.03 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.006 fold change" | 27058005 |
| CancerPDF_ID12698 | SVQLTEKRMD | Complement C3 | Serum | 1206.7 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.024 fold change" | 27058005 |
| CancerPDF_ID12699 | RIHWESASLL | Complement C3 | Serum | 1211.694 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.17 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.157 fold change" | 27058005 |
| CancerPDF_ID12700 | HRIHWESASLL | Complement C3 | Serum | 1348.755 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.59 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.042 fold change" | 27058005 |
| CancerPDF_ID12701 | THRIHWESASLL | Complement C3 | Serum | 1449.804 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12702 | SKITHRIHWESAS | Complement C3 | Serum | 1551.893 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.18 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.156 fold change" | 27058005 |
| CancerPDF_ID12703 | ITHRIHWESASLL | Complement C3 | Serum | 1562.888 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.30 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12704 | SVQLTEKRMDKVGK | Complement C3 | Serum | 1634.944 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.95 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.049 fold change" | 27058005 |
| CancerPDF_ID12705 | KITHRIHWESASLL | Complement C3 | Serum | 1690.987 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.36, Upregulated in BC vs healthy with 1.341 fold change" | 27058005 |
| CancerPDF_ID12706 | SKITHRIHWESASLL | Complement C3 | Serum | 1778.018 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.37, Upregulated in BC vs healthy with 1.343 fold change" | 27058005 |
| CancerPDF_ID12707 | KITHRIHWESASLLR | Complement C3 | Serum | 1847.095 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.30, Upregulated in BC vs healthy with 1.623 fold change" | 27058005 |
| CancerPDF_ID12708 | SSKITHRIHWESASLL | Complement C3 | Serum | 1865.05 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.06 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.344 fold change" | 27058005 |
| CancerPDF_ID12709 | SSKITHRIHWESASLLR | Complement C3 | Serum | 2021.146 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.844 fold change" | 27058005 |
| CancerPDF_ID12710 | GFKSHALQLNNRQI | Complement C4 | Serum | 1625.946 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.68 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.78, Upregulated in BC vs healthy with 0.763 fold change" | 27058005 |
| CancerPDF_ID12711 | NGFKSHALQLNNRQ | Complement C4 | Serum | 1626.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.56 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.80, Upregulated in BC vs healthy with 0.754 fold change" | 27058005 |
| CancerPDF_ID12712 | NGFKSHALQLNNRQI | Complement C4 | Serum | 1739.971 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.76 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.83, Upregulated in BC vs healthy with 0.796 fold change" | 27058005 |
| CancerPDF_ID12713 | GFKSHALQLNNRQIR | Complement C4 | Serum | 1782.012 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.092 fold change" | 27058005 |
| CancerPDF_ID12714 | NGFKSHALQLNNRQIR | Complement C4 | Serum | 1896.068 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 0.968 fold change" | 27058005 |
| CancerPDF_ID12715 | HFFFPK | Clusterin | Serum | 822.485 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.10, Upregulated in BC vs healthy with 1.029 fold change" | 27058005 |
| CancerPDF_ID12716 | FPKSRIV | Clusterin | Serum | 846.533 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.50 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.21, Upregulated in BC vs healthy with 1.139 fold change" | 27058005 |
| CancerPDF_ID12717 | HFFFPKSRIV | Clusterin | Serum | 1277.758 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.39 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.117 fold change" | 27058005 |
| CancerPDF_ID12718 | RPHFFFPKSRIV | Clusterin | Serum | 1530.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.106 fold change" | 27058005 |
| CancerPDF_ID12719 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2602.306 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.073 fold change" | 27058005 |
| CancerPDF_ID12720 | FLAEGGGVR | Fibrinogen alpha chain | Serum | 905.065 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.28 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.203 fold change" | 27058005 |
| CancerPDF_ID12721 | SSSYSKQFTSSTS | Fibrinogen alpha chain | Serum | 1396.795 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.01, Upregulated in BC vs healthy with 0.963 fold change" | 27058005 |
| CancerPDF_ID12722 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 1665.957 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.65 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.06, Upregulated in BC vs healthy with 1.083 fold change" | 27058005 |
| CancerPDF_ID12723 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 2553.201 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.60 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 0.992 fold change" | 27058005 |
| CancerPDF_ID12724 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 2659.323 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.033 fold change" | 27058005 |
| CancerPDF_ID12725 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.32 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.35 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.18, Upregulated in BC vs healthy with 1.074 fold change" | 27058005 |
| CancerPDF_ID12726 | SSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.376 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 1.128 fold change" | 27058005 |
| CancerPDF_ID12727 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3005.608 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 2.39, Upregulated in BC vs healthy with 2.324 fold change" | 27058005 |
| CancerPDF_ID12728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3206.443 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" | 27058005 |
| CancerPDF_ID12729 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3277.592 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" | 27058005 |
| CancerPDF_ID12730 | QAGAAGSRMNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1717.941 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.91 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.276 fold change" | 27058005 |
| CancerPDF_ID12731 | QAGAAGSRMNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1804.918 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.93 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12732 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1889.031 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.14 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.08, Upregulated in BC vs healthy with 1.244 fold change" | 27058005 |
| CancerPDF_ID12733 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2051.125 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.80 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.02, Upregulated in BC vs healthy with 1.047 fold change" | 27058005 |
| CancerPDF_ID12734 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2271.203 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.99 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.221 fold change" | 27058005 |
| CancerPDF_ID12735 | NVHSGSTFFKYYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2582.393 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.38 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 0.975 fold change" | 27058005 |
| CancerPDF_ID12736 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2627.365 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.51 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.86, Upregulated in BC vs healthy with 0.931 fold change" | 27058005 |
| CancerPDF_ID12737 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2724.46 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12741 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3969.989 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" | 27058005 |
| CancerPDF_ID12742 | RPPGFSPF | Kininogen-1 | Serum | 904.5017 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.29 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.40, Upregulated in BC vs healthy with 0.902 fold change" | 27058005 |
| CancerPDF_ID12743 | RPPGFSPFR | Kininogen-1 | Serum | 1060.627 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 0.818 fold change" | 27058005 |
| CancerPDF_ID12744 | GHKHERDQGHGHQ | Kininogen-1 | Serum | 1522.838 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.81 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.118 fold change" | 27058005 |
| CancerPDF_ID12745 | HGHKHERDQGHGHQ | Kininogen-1 | Serum | 1659.808 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.65, Upregulated in BC vs healthy with 1.231 fold change" | 27058005 |
| CancerPDF_ID12746 | GHGHKHERDQGHGHQ | Kininogen-1 | Serum | 1716.955 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.154 fold change" | 27058005 |
| CancerPDF_ID12747 | NLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 1943.95 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.43, Upregulated in BC vs healthy with 1.386 fold change" | 27058005 |
| CancerPDF_ID12748 | HGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2070.011 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 1.201 fold change" | 27058005 |
| CancerPDF_ID12749 | HNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2081.006 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.71, Upregulated in BC vs healthy with 1.565 fold change" | 27058005 |
| CancerPDF_ID12750 | GHGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2127.055 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.48, Upregulated in BC vs healthy with 1.279 fold change" | 27058005 |
| CancerPDF_ID12751 | KHNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2209.11 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.29, Upregulated in BC vs healthy with 1.499 fold change" | 27058005 |
| CancerPDF_ID12752 | KHNLGHGHKHERDQGHGHQR | Kininogen-1 | Serum | 2365.208 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.62 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.87, Upregulated in BC vs healthy with 1.340 fold change" | 27058005 |
| CancerPDF_ID12753 | GGPGGAGVARGGAGGGP | Neurogranin | Serum | 1251.732 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.16 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.07, Upregulated in BC vs healthy with 1.103 fold change" | 27058005 |
| CancerPDF_ID12754 | TPHPRPAPQSKPLASSGVPE | RIMS-binding protein-2 | Serum | 2053.134 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.77 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.99, Upregulated in BC vs healthy with 1.495 fold change" | 27058005 |