Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID8646 | ALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA | Alpha 1 antichymotrypsin peptide ( C terminal fragment of protein AACT) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
CancerPDF_ID8647 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthretin ( Cterminal fragment of protein TTHY) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
CancerPDF_ID8648 | ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN | Osteopontin ( C terminal fragment of protein OPN) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
CancerPDF_ID8649 | MKWVTFISLLFLFSSAYSRGVFRR | Albumin peptide (N terminal fragment of protein albumin) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Downregulated in cancer as compare to normal control | 19674866 |