Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID3569 | AILDETKGDYEK | Annexin A1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4659 | DMNDIKAFYQKMY | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4660 | DMNDIKAFYQKMYGI | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6519 | QFDADELRAAMKGLGTDEDTL | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6787 | SEFLKQAWF | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6788 | SEFLKQAWFI | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6958 | SLCQAILDETKGDYEKI | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6959 | SLCQAILDETKGDYEKILV | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7047 | SPYPTFNPSSDVAALHKAIMV | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7864 | VLALLKTPAQFDADELRAA | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7865 | VLALLKTPAQFDADELRAAMKGLGTDEDTL | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9546 | SEDFGVNEDLADSDAR | Annexin A1 | Serum | 870.37 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID13096 | ATIIDILTK | Annexin A1 | Plasma | 987.609 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |