| Primary information |
|---|
| sequence ID | Seq_752 |
| Peptide sequence | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG |
| CancerPDF_ID | CancerPDF_ID11031, |
| PMID | 21805675 |
| Protein Name | Collagen alpha-1(III) chain |
| UniprotKB Entry Name | CO3A1_HUMAN |
| Fluid | Urine |
| M/Z | 4306.9377 |
| Profiling Technique | MALDI-TOF |
| Peptide Identification technique | MALDI-TOF-MS |
| Labelled/Label Free | Label Free |
| FDR | 1 |
| CancerPDF_ID | CancerPDF_ID11031, |
| p-Value | NA |
| Software | NA |
| Length | 48 |
| Cancer Type | Muscle-invasive bladder cancer |
| Database | SwissProt Database |
| Modification | "Oxidation: 14, 19, 20, 26, 29, 37, 41, 47" |
| Number of Patients | 751 bladder cancer and 127 control |
| Regulation | Differentially expressed between cancer vs normal samples |
| Validation | Mann-Whitney tests and areas under receiver-operator characteristic |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |